PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr039366.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 579aa    MW: 64291 Da    PI: 4.8529
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr039366.2genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4523.7e-1382095782374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++lL+ecA a+s+g+ e+a++++++l++++s +gdp+qR+aay++e+Laarla+s++ lyk+l+++e +   ss +laa+++++ev+P++kf++++aN
  Pbr039366.2 209 KQLLFECAGALSEGNIEEASTMINELRQMVSIQGDPTQRIAAYMVEGLAARLASSGKFLYKSLKCKEPP---SSYRLAAMQILFEVCPCFKFGFMAAN 303
                  589*****************************************************************9...9************************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                   aI ea + e+rvHiiDfd++qG Q+++L+q+L+s p++pp+l++Tgv++pe++  +   l+ +g+rL+k+Ae l+vpfef++ va+r++ ++ ++L 
  Pbr039366.2 304 GAIIEACKDEKRVHIIDFDVNQGNQYITLIQTLSSLPGKPPHLKLTGVDDPETVqrHVGGLNIIGQRLEKLAEVLKVPFEFHA-VASRTSIVNASMLG 400
                  ****************************************************99888999***********************.7************* PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  ++pgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++F  rf+ea +yysa++dsl+a lpr+s++r++vEr++l+r+
  Pbr039366.2 401 CRPGEALVVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLRPKLVTVVEQDVNTNTTPFIPRFVEAYNYYSAVYDSLDAALPRDSQDRMNVERQCLARD 498
                  ************************************************************************************************** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ivn+vaceg+er+er e ++kWr+r+++aGF++ p+s++++++++ l r+++++ y+v+ee g+l +gW+d++L+++SaWr
  Pbr039366.2 499 IVNIVACEGEERIERYEVAGKWRARMTMAGFTSCPMSTSVTDSIRDLSRQYSDR-YKVKEEAGALHFGWQDKSLIVASAWR 578
                  ***************************************************966.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.001182559IPR005202Transcription factor GRAS
PfamPF035141.3E-135209578IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MSLVRPAELS TTSYRNRKLY SLNGSNDGSS LSTQIFGADE HKAVYVNDSY SSETYEKYFL  60
DSPMEEVTHP SSSGISGSST NPQGASSYQL TAGSVSSLNT QNPYITSLMS NFESDYLESQ  120
SPGADSFDED KMRLKLQELE RALLDDNDDE DDGEINCSSR SMEVDGEWID PIHSELLHDS  180
PKEYSSSDSN ASSISSKKEI SHASPRTPKQ LLFECAGALS EGNIEEASTM INELRQMVSI  240
QGDPTQRIAA YMVEGLAARL ASSGKFLYKS LKCKEPPSSY RLAAMQILFE VCPCFKFGFM  300
AANGAIIEAC KDEKRVHIID FDVNQGNQYI TLIQTLSSLP GKPPHLKLTG VDDPETVQRH  360
VGGLNIIGQR LEKLAEVLKV PFEFHAVASR TSIVNASMLG CRPGEALVVN FAFQLHHMPD  420
ESVSTVNQRD QLLRMVKSLR PKLVTVVEQD VNTNTTPFIP RFVEAYNYYS AVYDSLDAAL  480
PRDSQDRMNV ERQCLARDIV NIVACEGEER IERYEVAGKW RARMTMAGFT SCPMSTSVTD  540
SIRDLSRQYS DRYKVKEEAG ALHFGWQDKS LIVASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-5522757822375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360694.10.0PREDICTED: scarecrow-like protein 1 isoform X1
RefseqXP_009360695.10.0PREDICTED: scarecrow-like protein 1 isoform X1
RefseqXP_009360696.10.0PREDICTED: scarecrow-like protein 1 isoform X1
RefseqXP_009360697.10.0PREDICTED: scarecrow-like protein 1 isoform X1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLD9ZJB00.0D9ZJB0_MALDO; SCL domain class transcription factor
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49883457
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1